PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG022356.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 526aa    MW: 57122.6 Da    PI: 6.0296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG022356.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.6e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
      CCG022356.1 40 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding39.61.3e-1293145146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT........TTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg........kgRtlkqcksrwqk 46 
                      +g++T+ E+ +++++++ +G++ W++ a+++g         gRt++++k++w++
      CCG022356.1  93 KGSFTPVEENRIIELHANMGNK-WARMAAEVGnlipdlklPGRTDNEIKNYWNT 145
                      799*******************.*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.753591IPR017930Myb domain
SuperFamilySSF466897.42E-2637143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-233890IPR009057Homeodomain-like
SMARTSM007172.4E-153989IPR001005SANT/Myb domain
PfamPF002492.2E-154087IPR001005SANT/Myb domain
CDDcd001675.78E-124287No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2291149IPR009057Homeodomain-like
SMARTSM007172.0E-1192149IPR001005SANT/Myb domain
PROSITE profilePS5129413.0892151IPR017930Myb domain
PfamPF002498.1E-1293145IPR001005SANT/Myb domain
CDDcd001672.91E-795145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MSSMMNGTED NKRSKGRQDS PAADEGNGGG MVGGITPLKK GPWTSAEDAI LIDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPD LKKGSFTPVE ENRIIELHAN MGNKWARMAA  120
EVGNLIPDLK LPGRTDNEIK NYWNTRTKRL QRAGLPLYPP EVCLRAYKMN KDGQNMGKLQ  180
TGDAHDPDMM LTDHFKIPEV EFKTLALNPG VLPYSTGLFD ASASSMLKQG VGSSYGRGLV  240
FPTIQPAKRF RESQTIFTGL DGSVSGGIPE FDQLTDYHRG KITGNFGLSS PYGCDLGNYD  300
QSSCGVLPGS HAILNGNSSS SSSSEPIYRA TKLELPSLQY SETQQDSWGT PASPLLSLES  360
VDTFIQSPPT ETKSDGQSPR SSGLLEAVLY ESQTLKHSKK CPDHQTSDAF VPIGCGVHSS  420
PLNARAAEWE LHADLNSPSG HSASSLFSEC TPISGSSSDE QAYNVKPEPI EQVLPYVEAG  480
EVLNQTDCNR PDVMLGSSSF APSNKYHNDQ FFQTDDVAAL LGGDQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28341491106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011007815.10.0PREDICTED: transcription factor GAMYB-like isoform X3
RefseqXP_011007812.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLB9GEM70.0B9GEM7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-90myb domain protein 33